SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386347300|ref|YP_006045549.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386347300|ref|YP_006045549.1|
Domain Number 1 Region: 34-97
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000118
Family Carboxypeptidase regulatory domain 0.022
Further Details:      
 
Domain Number 2 Region: 108-214
Classification Level Classification E-value
Superfamily TPR-like 0.000000179
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386347300|ref|YP_006045549.1|
Sequence length 237
Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence
MRVYFVRVFFLLMGTMFLLSCVSGPQMEESFVLQGMVYDRAGNPVTDAVIEIEGKQMGVS
DFNGRFYIPGMVPGTYTVGVQKEGYLPYEGTVAIRSHTDVLYVGMVSWEDLCRRAERALQ
EGRWGEAEQAISRALEIKPDEPLVRFLAAVVCAMPARPERRPDRAVELLEDLLSEGYREP
AIYLMLADLYEYDFKDLVKAEERLSQYLSLKQDTEAENRLAALRDMLLLSSKPDGQK
Download sequence
Identical sequences G0GAT6
gi|386347300|ref|YP_006045549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]