SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386347463|ref|YP_006045712.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386347463|ref|YP_006045712.1|
Domain Number 1 Region: 450-536
Classification Level Classification E-value
Superfamily TPR-like 0.0000011
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386347463|ref|YP_006045712.1|
Sequence length 668
Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence
MEGQRVRTSGRHVAGLVVLLAVLFPAGAQEPSADVPSIQVSAARIKRTERLTLDLSVPLD
APGEPVEVIPPPVPEILSLLVGPLVQPVKDPEGKPMLRYRYTFQGVRSGRRIWGPFQVRR
GGKVYHTDPFLIEVSYRGDIDKVAYDVEWEAPERILARQSVPITLYIRHLDRIVLPDRVQ
IPELRGAFVEEVPVLAPVEEESMGAHTLYHVPVKTFMITPYESGTIRLPPATVILGGMEE
SGGALTVRVDPLPQSSSLHGVGRFEFYATRTVSTVQVGELFGIRLLVKGVGNFPFLSFPQ
PDPGDLAVLVREEEDEEYRASTEGYSGWRQRTYWFRAVEEGRLTVRIPPFRYVPPGQNGV
RSAGGTSLAVEVREENVTPALTFLSLDEVRSLQGRWIAEDLRVLFLIIPMVLALFSLLVP
SKRFGGYALVVCTASWAGLLLWILLVPPDFPLPEQELQEGLAFLEREDYGKAYEAFQEAL
DEEELAPGIHYDAAMAAYALGEDGRVVYHLRRACVQAPMVLILRKALSHMEEEIGLQYQA
ALPVAFPPGIPWLGLITGCTLSGLFFAAYIRWRSPVLLITLLLSLSATIVAGGYVFYRAV
VFREPQAVVVSETPLQAVPEEEGRRLQICPAGTAVRTDYLYQDYVRVHTGMGTSGWVRRD
TLQWYIGR
Download sequence
Identical sequences G0GBY4
WP_014625324.1.62259 gi|386347463|ref|YP_006045712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]