SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386347767|ref|YP_006046016.1| from Spirochaeta thermophila DSM 6578

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386347767|ref|YP_006046016.1|
Domain Number 1 Region: 11-58
Classification Level Classification E-value
Superfamily TPR-like 0.00000000417
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386347767|ref|YP_006046016.1|
Sequence length 73
Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence
MISETKKKVLEYFARGRNYYKMMEFEKAREEFAKALALDPEDGPSKVYYARCLHYMKNPP
PEDWDGVFEMTTK
Download sequence
Identical sequences E0RQF1 G0GEG2
gi|307719668|ref|YP_003875200.1| WP_013314766.1.44968 WP_013314766.1.62259 gi|386347767|ref|YP_006046016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]