SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300173506|ref|YP_003772672.1| from Leuconostoc gasicomitatum LMG 18811

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300173506|ref|YP_003772672.1|
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily Formyltransferase 4.97e-56
Family Formyltransferase 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300173506|ref|YP_003772672.1|
Sequence length 196
Comment phosphoribosylglycinamide formyltransferase [Leuconostoc gasicomitatum LMG 18811]
Sequence
MVKSVRLAVFASGTGTNFQALHDAILQRHLHAEIVRLIVDKSAAGALNLAKIFGIPATFI
KYSEYKTKPEAEQAILNQLKIDEVDGILLAGYMRILTPTLIDNYPSKIINLHPAMLPNFP
GRHSILDAYEADVDMTGVTVHFVDNGIDTGKIIAQQKVPRLPNDTLQDLETRMHNVEHVL
YPNTLEQLLNEGVFLK
Download sequence
Identical sequences A0A175BWK8
WP_010390621.1.38079 WP_010390621.1.48 WP_010390621.1.68540 WP_010390621.1.81830 WP_010390621.1.8421 WP_010390621.1.87361 WP_010390621.1.90721 gi|300173506|ref|YP_003772672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]