SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300173619|ref|YP_003772785.1| from Leuconostoc gasicomitatum LMG 18811

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300173619|ref|YP_003772785.1|
Domain Number 1 Region: 5-82,174-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.34e-56
Family Bacterial dinuclear zinc exopeptidases 0.0000398
Further Details:      
 
Domain Number 2 Region: 72-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.14e-22
Family Aminopeptidase/glucanase lid domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300173619|ref|YP_003772785.1|
Sequence length 358
Comment glutamyl aminopeptidase [Leuconostoc gasicomitatum LMG 18811]
Sequence
MNAKTWARVQKYTELQGTSGQEQTIRKAFRDELLPLVNDIKQDGLGGVFGVKNNSDLHAP
RVMFAAHMDEVGFIVTNVLPNGTLKVAAVGGWNPTVISSQRFTLFTTNGAYPIVSSSVSP
HLLRGRDSQITLPTVDDILFDAGFVDQAEAHAFGVFPGDFIVPEVATIMTANKKRVISKA
WDNRFGMVTILEALDALKDVQTPNTLIMGADVQEEVGLRGAHGAVNLMKPDVFFAIDSSA
ADDVNGSVGRQGILDQGTLLRVFDPTVVLPLRLKEFLLSTAEDNHIPYQYFVSKGGTDAA
AAQSERTGIPSVALGVASRYIHTHQTIWSISDFEAAKDFVIAIAKNLDETNLKTILGD
Download sequence
Identical sequences A0A175BYR9
WP_013231765.1.38079 WP_013231765.1.48 WP_013231765.1.68540 WP_013231765.1.8421 WP_013231765.1.87361 WP_013231765.1.90721 gi|300173619|ref|YP_003772785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]