SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300172792|ref|YP_003771957.1| from Leuconostoc gasicomitatum LMG 18811

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300172792|ref|YP_003771957.1|
Domain Number 1 Region: 12-280
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.15e-28
Family ADP-ribosylglycohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300172792|ref|YP_003771957.1|
Sequence length 312
Comment hypothetical protein LEGAS_0490 [Leuconostoc gasicomitatum LMG 18811]
Sequence
MVKKQATIELLMFGMAVGESMTQLSNSQQDELLQDPIQFTEELSWGSQTSLSLTTIASLS
RGYQLTDVMNHFQNWYKRRQFVPENTVQHVDAITKKAMDNYTKNRDTLASGVLEDIADSE
NILVRMLPVALYLHHEYGVSFINDETAMLTLHRIAGLTHNDEGALVSVGMLSLIISQILD
GQSLRDAVENGLAFGFEYYSRHKVFESELIAFEELNLPDFANIPVNHIKLDGRSASTLEA
IIWSLLNSNSYVQAMQNAFLHGHANSIIPTAVSAIAAVFYDDDLVLQASQHLISRKLIVS
VTRQAERLGRFN
Download sequence
Identical sequences A0A175CJ94
gi|300172792|ref|YP_003771957.1| WP_010383106.1.38079 WP_010383106.1.48 WP_010383106.1.68540 WP_010383106.1.81830 WP_010383106.1.8421 WP_010383106.1.87361 WP_010383106.1.903 WP_010383106.1.90721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]