SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298292011|ref|YP_003693950.1| from Starkeya novella DSM 506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298292011|ref|YP_003693950.1|
Domain Number 1 Region: 640-1089
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-129
Family ALDH-like 0.000000277
Further Details:      
 
Domain Number 2 Region: 252-601
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000102
Further Details:      
 
Domain Number 3 Region: 82-251
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.44e-63
Family N-terminal domain of bifunctional PutA protein 0.000000588
Further Details:      
 
Domain Number 4 Region: 3-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000295
Family PutA pre-N-terminal region-like 0.0078
Further Details:      
 
Weak hits

Sequence:  gi|298292011|ref|YP_003693950.1|
Domain Number - Region: 1137-1236
Classification Level Classification E-value
Superfamily ALDH-like 0.00262
Family ALDH-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298292011|ref|YP_003693950.1|
Sequence length 1276
Comment delta-1-pyrroline-5-carboxylate dehydrogenase [Starkeya novella DSM 506]
Sequence
MSTTTIGVKIDEELRARLKAAAEREGRSPHALVKQALIAAVERTERGMPAVAADTAAMLA
ADAGSAPQESPFLPFARSIQPQSVLRARITSAYRMPETEAVPMLIGPASLPEAKAEAAKE
RARSLVESLRAKGQKGPVEGLIHEYSLSSQEGVALMCLAEALLRIPDRATRDALIRDKIG
HGDWHAHVGQSPSLFVNAATWGLVLTGKLTTTSSEAGLSGALTRLIGRGGEPLIRKGVDV
AMRMMGEQFVTGQTISEALANSRRMEAKGFRYSFDMLGEAATTEADARRYLADYEQAIHA
IGKASAGRGIYEGPGISIKLSALHPRYSRAQYSRVVNELLPRVVTLAKLARQYDIGLNID
AEEADRLEISLDLLESLCFDESLSGWNGIGFVVQAYQKRCPYVIDYLIDLARRSNHRIMV
RLVKGAYWDSEIKRAQVDGLEGFPVYTRKVHTDVAYLACARKLLAAPDAVFPQFATHNAQ
TLSAVMEMAGANYYAGQYEFQCLHGMGEPLYEEVVGREKLGRPCRIYAPVGTHETLLAYL
VRRLLENGANSSFVNRIADEAVPVDELIESPVAAASRIEPMGAPHPRIAAPDDLFGEERR
NSAGLDLSNEQRLASLAAALLAGSAVPLKAVPLLGDGPAEGVARPVLNPADHRDQVGTVE
EATPETVARAMEIAQGAAPIWQSTPPEERAQCLSRAADLMEARMPALIGIIVREAGKSFP
NAIGEVREAVDFLRYYGAQLKGWSGDTHRPLGPVVCISPWNFPLAIFTGQVAAALASGNA
VLAKPAEETPLIAHAAVEILREAGVPPGAVQLVPGGGEVGAALVGDARTRGVMFTGSTEV
ARLIQSQLAERLSPEGGVIPLIAETGGQNAMIVDSSALAEQVVADVLSSAFDSAGQRCSA
LRILCLQEDVADRMLEMLRGALKELSVGNPVQLSTDIGPVITAEARETIEAHIARMRKAG
RPVEQLELDAETRHGTFVPPTLIEIDDIAELHREVFGPVLHVVRYRRDDLDALIDAIDAT
GYGLTFGLHTRIDETIAHVGARIEAGNVYVNRNIIGAVVGVQPFGGHGLSGTGPKAGGPL
YLQRLLSVRPSIALPAAGAPEPARLWTDFVSDPATRALCGAVLDASPYGHKAELSGPVGE
RNVYVLKPRGTVLCLAATERGLAVQIASVLATGNRVLLEGTDLPALPAGLESHVGITDDL
ASARFDAVLFEGDSDALHRLNGEIAARGGPIVLVHGLHPDALARGELYPLDLLMLEGATS
INTAAAGGNASLMSIG
Download sequence
Identical sequences D7A070
gi|298292011|ref|YP_003693950.1| WP_013166835.1.82231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]