SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298293297|ref|YP_003695236.1| from Starkeya novella DSM 506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298293297|ref|YP_003695236.1|
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily YggU-like 5.89e-19
Family YggU-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298293297|ref|YP_003695236.1|
Sequence length 106
Comment hypothetical protein Snov_3343 [Starkeya novella DSM 506]
Sequence
MSAPLPWTLAPDGLVVTVRATPRGGRDAIDGFVELGDGRTALKARVSVAAEDGKANAALG
KLLAKAAGIAPSRVDLVSGATGRTKAFKLNGDAAEIAARLQALIGE
Download sequence
Identical sequences D7A8T3
WP_013168118.1.82231 gi|298293297|ref|YP_003695236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]