SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298291318|ref|YP_003693257.1| from Starkeya novella DSM 506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298291318|ref|YP_003693257.1|
Domain Number 1 Region: 312-440
Classification Level Classification E-value
Superfamily TPR-like 3.16e-16
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298291318|ref|YP_003693257.1|
Sequence length 491
Comment peptidase M48 Ste24p [Starkeya novella DSM 506]
Sequence
MTLSPRQRQVAPNHFRRWMMPSLLPDNPSIGRPAARGLGLVAALALAAAPAVAQAQSRQP
GIIRDAEIETLLRDYTRPVFRAAGLTQQNIQIVLVGSDSFNAFVADGRRIFINTGALKQA
KTPNEIIGVLAHETGHIAGGHLANMRQQLESVQTAAIVGMLLAVGGIAAGASTGASLGGA
PAAALIAPQEIARRTLLSYQRGQEASADRAAVTYLNATKQSARGMLTTFERFQNDQIFLS
QRVDPYVLSHPMATERIALLSELAHKSPYFNATDPPALQARHDMMRAKLVGFTQQPESVS
RVYPPSNTSLPARYARAISAYRFGSIPDALRQIDALIAEQPNNPYFYEIKGQALLEAGRA
REAVPPLRRAVALSNGHPLIRMLLGQALVATDDKSTAEEAVRELNFSLQREPDSPGGWRY
LAMAYGRKGDIPNADLASAQSAFLGGDFRLARELATRAKNGFKLGSPGWLKADDIVNFKP
PPERRKKPPGP
Download sequence
Identical sequences D7A8G5
gi|298291318|ref|YP_003693257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]