SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298292160|ref|YP_003694099.1| from Starkeya novella DSM 506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298292160|ref|YP_003694099.1|
Domain Number 1 Region: 228-354
Classification Level Classification E-value
Superfamily TPR-like 7.59e-24
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298292160|ref|YP_003694099.1|
Sequence length 372
Comment hypothetical protein Snov_2184 [Starkeya novella DSM 506]
Sequence
MLDFGVFTLPAVAAAMVFVAALFVGEDIVIEKVYVPQVREWTGYTSTVATRILTDELREL
SVAAASELQAINIDEGGVEKGISAFEDYFEVGLLINGTRNVLGLIKYYINGEITEVNNET
QLIIRIYTKKEDEPVKLIVVRGKSDDLDGLLHEGGVQILEYINPYVIALYHRRTELAAKQ
FDFPKTNETIKKFLETQPPEQHFLAYGLLGRMNMLKAERDTTLTPEQRQKEYDEAVELLD
AALRQQPDFLYPLINLGIIYAGRKEYDRADEYFARAVKQNPNYLVSRTAWGDMLIERGLL
DDAVIQYEAAVLISPHDDKLQAKLADLYERTGQPEKAQEQIEKALKLNPISQAYLDKEKA
LEEKNRTTATVQ
Download sequence
Identical sequences D7A1C2
WP_013166984.1.82231 gi|298292160|ref|YP_003694099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]