SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298292992|ref|YP_003694931.1| from Starkeya novella DSM 506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298292992|ref|YP_003694931.1|
Domain Number 1 Region: 195-303
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000127
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  gi|298292992|ref|YP_003694931.1|
Domain Number - Region: 71-105
Classification Level Classification E-value
Superfamily Prefoldin 0.0233
Family Prefoldin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298292992|ref|YP_003694931.1|
Sequence length 321
Comment tol-pal system protein YbgF [Starkeya novella DSM 506]
Sequence
MILRVPRSAVVVLAATLAAALLPYEAAQAQADNNFFGNLFKPPGQVRSGGTTGGTAGGEA
VGEEQGGITVRIDRLENQLRQLTGQIEQLQYRNQQLEQQLRALQGEMDFRVGGANAGAAP
RPAAAGPAPAAADAAPGRRSDAFDPSAPGAAPGAPRPLGTTAPSGPVGGLPGAPMDLGAL
SGAAATGGNPMPPSNSPKDLYDLAYGYMLRQDYAQSATSFEQFIKLYPNDRAAPDAYYWL
GETQFQRKTYKEAAQNFLKVSTDYPNAVKAPDALLRLGQSLAAIGEKDAACATLNAVNNK
YPRASATIKQGVAQEQKRAGC
Download sequence
Identical sequences D7A781
gi|298292992|ref|YP_003694931.1| WP_013167815.1.82231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]