SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300782245|ref|YP_003762536.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300782245|ref|YP_003762536.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.66e-106
Family FMN-linked oxidoreductases 0.00000000308
Further Details:      
 
Domain Number 2 Region: 334-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.59e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000118
Further Details:      
 
Domain Number 3 Region: 461-519,554-648
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-22
Family C-terminal domain of adrenodoxin reductase-like 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300782245|ref|YP_003762536.1|
Sequence length 670
Comment NADPH-dependent 2,4-dienoyl-CoA reductase [Amycolatopsis mediterranei U32]
Sequence
MSPYPHLLSPLDLGFTTLRNRVLMGSMHTGLEDKAAHFPALAEYYAERARGGVGLIVTGG
FAPNRTGWLLPLASKLTTSAEAKRHRQLTTPVHEAGGKIALQILHAGRYAYHPLSVSASS
IKAPINPFRPRALTGYGVRQQIRAFADCAALAREAGYDGIEIMGSEGYLINQFLAERTNK
RTDAWGGTPEKRRRFAVEIVKRTREKAGDDFIIIYRLSMLDLVPGGQRWEDVVALAQEVE
AAGATIINTGIGWHEARVPTIVTSVPRAAFTWVTGKLKPHVTIPVVTSNRINMPQVAEEA
LSSGDADLVSMARPFLADPEWIRKAETGRDDEINTCIACNQACLDHAFKRKLVSCMVNPR
AGHETTLTLAPARRTKHVAVVGAGPAGLAAATALAERGHSVELFEADAEIGGQFGIARKI
PGKEEFAETIRYYRRRLEVTGVKLHLGKRVAAAELTGFDEVVLATGVAPRVPSLPGIDHP
KVLSYVDVVKHGKPVGERVAVIGAGGIGVDVSEFLTHTSSPALDLDAWLAEWGVTDPEQA
AGGLGTPRPEPSPRQVFLLQRKKSGIGAGLGKTSGWVHRAALKAKKVEQLTGVTYERIDD
DGLHITVDGEPRLLDVDTVVVCAGQEPVRDLADDLRAAGLPVHLIGGADVAAELDAKRAI
DQGTRLAAAL
Download sequence
Identical sequences A0A0H3CW25 G0G8I7
gi|532456987|ref|YP_008456639.1| gi|399534125|ref|YP_006546787.1| WP_013222260.1.26188 WP_013222260.1.53613 WP_013222260.1.63706 WP_013222260.1.79787 WP_013222260.1.88400 WP_013222260.1.99940 YP_003762536.1.66228 gi|300782245|ref|YP_003762536.1| gi|399534125|ref|YP_006546787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]