SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300782728|ref|YP_003763019.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|300782728|ref|YP_003763019.1|
Domain Number - Region: 25-90
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0275
Family Outer membrane efflux proteins (OEP) 0.012
Further Details:      
 
Domain Number - Region: 77-121
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0863
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300782728|ref|YP_003763019.1|
Sequence length 141
Comment hypothetical protein AMED_0797 [Amycolatopsis mediterranei U32]
Sequence
MEDTSSARIRAADADRERVATTVQTAGAEGRLTLDEVEERLSRVYSARFTDELAALTTDL
PRPAPPSPGFPLTREALRRHPALRVHLAVVVAIAVLVVVRWAVLGAGFFWPAFPVFWLGM
SLLVHARVRSVRQRPRAAVPY
Download sequence
Identical sequences A0A0H3CVE0 G0FXG6
WP_013222710.1.26188 WP_013222710.1.53613 WP_013222710.1.63706 WP_013222710.1.79787 WP_013222710.1.88400 WP_013222710.1.99940 YP_003763019.1.66228 gi|399534614|ref|YP_006547276.1| gi|399534614|ref|YP_006547276.1| gi|532457476|ref|YP_008457128.1| gi|300782728|ref|YP_003763019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]