SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300784115|ref|YP_003764406.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300784115|ref|YP_003764406.1|
Domain Number 1 Region: 24-303
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.65e-61
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000909
Further Details:      
 
Weak hits

Sequence:  gi|300784115|ref|YP_003764406.1|
Domain Number - Region: 309-383
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00187
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300784115|ref|YP_003764406.1|
Sequence length 560
Comment ubiquinol-cytochrome C reductase cytochrome b subunit [Amycolatopsis mediterranei U32]
Sequence
MSSLTTPTKGSSPVEKALGDAANNADQRYHLAKGLRHQLNKVFPTHWSFLLGEIALYSFI
ILLLTGVYLTLFFDPSMQEVVYHGSFKNMQGLEMSQAFRTTLDISFDVRGGLFMRQLHHW
AALIFVASMAVHMLRIFFTGAFRRPREANWVIGGLLLVLGCFEGFFGYSLPDDLLSGTGI
RATLSGIVLSVPVAGTWIHWALFGGEFPGDQIIPRLYTLHILLLPGIMLALVGVHLALVW
YQKHTQFPGVRRKETNVVGVRIMPYFALKGGAFFTLVIGVLALMSGLFQINPVWNFGPYN
PAQVSAGSQPDWYMAWADGMLRIWPAWEVYLGNYTIPAVFFPGAVGMPILIGLLLAYPFL
ERKLSKDTAHHNLLQRPRDAPVRTALGAMALGFFLVIELSGFNDIIADQFDISLNATTWA
GRIGVLLVPPVAYYLTYRLCLGLQRADREVLEHGVETGIIKRLPHGEFIEIHQPLAGVDS
HGHAIPLEYQGASVPKKMNKLGSAGHAVPGTFWSPDPAEETAALQRANGNGHSGAENGQH
GQHGEFDSAETASTAKQSDH
Download sequence
Identical sequences A0A0H3D1D1 G0G3G3
gi|399536000|ref|YP_006548662.1| gi|300784115|ref|YP_003764406.1| WP_013224083.1.26188 WP_013224083.1.53613 WP_013224083.1.63706 WP_013224083.1.79787 WP_013224083.1.88400 WP_013224083.1.99940 YP_003764406.1.66228 gi|399536000|ref|YP_006548662.1| gi|532458862|ref|YP_008458514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]