SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300784538|ref|YP_003764829.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|300784538|ref|YP_003764829.1|
Domain Number - Region: 108-184
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0377
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300784538|ref|YP_003764829.1|
Sequence length 209
Comment hypothetical protein AMED_2632 [Amycolatopsis mediterranei U32]
Sequence
MTTATRSPQNTLVHSYLFLRRAIGLIGLALPVVLVLGKQLVQGGDLIGSLSGYYYTDLRD
VLVGAMCAVGVFLLAYYGHDYVDNVASTVAGLGAIGLALFPTTPDHDVTAWDRTSGVLHW
VFAAVFFLSLAYFCLRLFPHDGEQPPGTGVVYRVCGVVILACLVLVALAKYLDLVPSLHP
ALWLESIAVEAFGVAWLVKGQTMEPKSVP
Download sequence
Identical sequences A0A0H3D2C9 G0G9A4
gi|399536423|ref|YP_006549085.1| gi|399536423|ref|YP_006549085.1| gi|300784538|ref|YP_003764829.1| gi|532459285|ref|YP_008458937.1| WP_013224502.1.26188 WP_013224502.1.53613 WP_013224502.1.63706 WP_013224502.1.79787 WP_013224502.1.88400 WP_013224502.1.99940 YP_003764829.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]