SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300787793|ref|YP_003768084.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|300787793|ref|YP_003768084.1|
Domain Number - Region: 6-76
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0259
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300787793|ref|YP_003768084.1|
Sequence length 183
Comment hypothetical protein AMED_5940 [Amycolatopsis mediterranei U32]
Sequence
MSSAVWYFSRATGLVSLVLFTGVVVLGALGAGRFATREWPRFAVAAVHRNLALTSLAFLA
AHIASAVLDGYVPLGWLDVVVPFGADYQPLWVGLGAVAIDLVLAIVVTSLVRTRLPARVW
RTVHWLAYLCWPVALVHGFGMAEDDSAYGWIVALDVLCVLAVLGSVGYRAAHVRKFAALG
GTR
Download sequence
Identical sequences A0A0H3DBP9 G0FW72
WP_013227735.1.26188 WP_013227735.1.53613 WP_013227735.1.63706 WP_013227735.1.79787 WP_013227735.1.88400 WP_013227735.1.99940 YP_003768084.1.66228 gi|532462537|ref|YP_008462189.1| gi|399539676|ref|YP_006552338.1| gi|399539676|ref|YP_006552338.1| gi|300787793|ref|YP_003768084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]