SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300787811|ref|YP_003768102.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300787811|ref|YP_003768102.1|
Domain Number 1 Region: 123-191
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000227
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300787811|ref|YP_003768102.1|
Sequence length 199
Comment hypothetical protein AMED_5959 [Amycolatopsis mediterranei U32]
Sequence
MPYDVKKDLKQLYAPKNTDWALVDVPEQRFLAIDGRGNPNTAESYRKAVEALYGFAYTIK
MVAKQRGEDFVVGPLEGLWWAEDYAAFTVRAKDSWQWTMLIAQPEWIGEDAVEEARETVR
RKKKLEAPVRLEKLHEGRCAQALHIGSYDDEGPLLARLHDEYLAAQGLKPTGLHHEVYLG
DPRRVEPAKLRTVLRQPVG
Download sequence
Identical sequences A0A0H3D9K2 G0FW92
WP_013227753.1.26188 WP_013227753.1.53613 WP_013227753.1.63706 WP_013227753.1.79787 WP_013227753.1.88400 WP_013227753.1.99940 YP_003768102.1.66228 gi|399539694|ref|YP_006552356.1| gi|300787811|ref|YP_003768102.1| gi|532462555|ref|YP_008462207.1| gi|399539694|ref|YP_006552356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]