SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300788381|ref|YP_003768672.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|300788381|ref|YP_003768672.1|
Domain Number - Region: 178-248
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0732
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300788381|ref|YP_003768672.1|
Sequence length 443
Comment integral membrane protein [Amycolatopsis mediterranei U32]
Sequence
MSIDQSEERTAEAPPEPRFTWAAVRPLLVRLHFYAGVFVGPFLLVAALTGLTYIWTPQVE
QAVYDHELHVPAAPGVVPLAQQTAVAKAAVPDGTITGIRPGPAATDSTQVIFNRPGLEPS
FHHTVFVDPHTGQIRGQLETYGSGQALPLRSWIDGLHANLQLGDFGRWYSELAASWLWVV
VLAGIALWIGSRKRKKPQSARGRLLSWHRMTGLVIAAGLLFLSATGLTWSEHAGDNISGL
RAQLDWTTPSVSTALPAVAPQGADVGIDAVRATTLQAGLSDPVEIRPPSGPGKAYVVAQV
GRSWPTKADSMAVDPATGRLTDTLPFSGYSLAAKLSRWGIDAHMGLLFGVANQIVLTGLA
VGLIAVIFWGYRMWWLRRPTRGEARVGRPPVRGAWRRIPGRVLAPFLVVTAVVGYYLPVF
GLSLLAFLVVDLIVGARHQEAKA
Download sequence
Identical sequences A0A0H3DBB0 G0FTV5
WP_013228319.1.26188 WP_013228319.1.53613 WP_013228319.1.63706 WP_013228319.1.79787 WP_013228319.1.88400 WP_013228319.1.99940 YP_003768672.1.66228 gi|399540264|ref|YP_006552926.1| gi|399540264|ref|YP_006552926.1| gi|532463125|ref|YP_008462777.1| gi|300788381|ref|YP_003768672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]