SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300788460|ref|YP_003768751.1| from Amycolatopsis mediterranei U32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300788460|ref|YP_003768751.1|
Domain Number 1 Region: 185-322
Classification Level Classification E-value
Superfamily CBS-domain pair 1.26e-32
Family CBS-domain pair 0.0017
Further Details:      
 
Domain Number 2 Region: 330-413
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000273
Family CorC/HlyC domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300788460|ref|YP_003768751.1|
Sequence length 447
Comment hypothetical protein AMED_6623 [Amycolatopsis mediterranei U32]
Sequence
MEQLFFAIALVLLAGVFAAADAAISTVSQARADGLARLGLPGARHLAAVVAERRRHINLL
LLLRLGCELTATVLVTVFVGTRLAPLGLAVLVTAVVMVVVSYVLIGVGPRTLGRQHPYRI
GRYVAGPVRVLGSVLGPLSRLLILIGNAITPGQGFREGPFTSEVELRELVDLAQERGVVE
DSEREMIHSVFELGDTVAREVMVPRTEIVWIERTKTVRQALALALRTGFTRLPVIDESVD
DIVGVVNIKDLMAGYLDPDGPSTVVDSVMNPASFVPDSKRLDELLKEMQRSHNHMAIAVD
EYGGTAGLLTIEDVLEEIVGEITDESDADERPEVEELDGGAVRVSSRMGIDDLGELFGID
LEDHDVETVGGLLAERLGRVPLPGAEAEVAGLRLFAEGGKDRRGRMRITSVVVHPADAEA
MTDPVDRTRRRTRLPHPDERDRSVEHA
Download sequence
Identical sequences A0A0H3DFD9 G0FWE1
WP_013228398.1.26188 WP_013228398.1.53613 WP_013228398.1.63706 WP_013228398.1.79787 WP_013228398.1.88400 WP_013228398.1.99940 YP_003768751.1.66228 gi|399540343|ref|YP_006553005.1| gi|300788460|ref|YP_003768751.1| gi|532463204|ref|YP_008462856.1| gi|399540343|ref|YP_006553005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]