SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296108716|ref|YP_003615665.1| from methanocaldococcus infernus ME

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296108716|ref|YP_003615665.1|
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.81e-38
Family GHMP Kinase, N-terminal domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 181-282
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.12e-22
Family Mevalonate kinase 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296108716|ref|YP_003615665.1|
Sequence length 287
Comment mevalonate kinase [methanocaldococcus infernus ME]
Sequence
MKAKGKVIFFGEHAVVYGYTALSLPINLSTNVNIKKNDNLVIELKNLNKKLGFEEAKKDK
DFRYVIKAIELLKVKEPFFLSVSSELPVSCGLGSSASVVVATIRALSKFFNLNLPKKEIA
KLSHRVEREVQGKASITDTYTISYERALKIRNNEFSFIDEFEKTVREEKLYIAYVEEREM
KTADLIKVVSEKEEKEEIFKEIEEITREALSSDVERIKELMLENHKLLDKLGVSTKGLNR
VVRLAKKFGCGAKLTGAGGGGCVIILGDLNEEEKELIEKIVKSLYLA
Download sequence
Identical sequences D5VU89
WP_013099448.1.24528 gi|296108716|ref|YP_003615665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]