SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302334913|ref|YP_003800120.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302334913|ref|YP_003800120.1|
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.000000000000445
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302334913|ref|YP_003800120.1|
Sequence length 98
Comment PTS system lactose/cellobiose-specific transporter subunit IIB [Olsenella uli DSM 7084]
Sequence
MAKMKHILLSCGSGIVTSTVARKKVEALLDSHGYKGQYEITQIPLASAPEKSRNYDFIVA
TSIAPTELHCPYVNGVPYLMGRGAEETDAQILKLMEED
Download sequence
Identical sequences E1QXX6
gi|302334913|ref|YP_003800120.1| WP_013250992.1.19134 WP_013250992.1.33448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]