SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335006|ref|YP_003800213.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335006|ref|YP_003800213.1|
Domain Number 1 Region: 7-229
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.93e-54
Family Class I glutamine amidotransferases (GAT) 0.0000152
Further Details:      
 
Domain Number 2 Region: 189-411
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.17e-49
Family N-type ATP pyrophosphatases 0.00000154
Further Details:      
 
Domain Number 3 Region: 398-529
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 5.23e-47
Family GMP synthetase C-terminal dimerisation domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302335006|ref|YP_003800213.1|
Sequence length 529
Comment GMP synthase [Olsenella uli DSM 7084]
Sequence
MQTSRPQQFVAVFDFGAQYGQLIARRVRDLNVYSEMVPCDISADELAAMAPAAIILSGGP
ASVYADDAPDMDGRIFELGVPILGFCYGQQIMAVKLGGKVGHTEKGEYGPAELCRCGESR
ILAGTPGSQTVWMSHRDAVSDVPAGFSVTSTTETCPIASMEDASRRFYATQFHPEVRHTA
CGQAMLENFLFGICGLGRSWTMDNIIDEKVAEIREQVGGRKVILALSGGVDSSVVAALVH
RAIGDQLTCVFVNHGLLRKGEPEMVEEVFREQFNVPLVHVHAEERYLRLLAGVSDPEQKR
RLIGGEFWKVFFEEAQKIGDVEMLAQGTIYPDIIESGARKTGGKASTIKSHHNLIPFPEG
VRFDLIEPLDHFFKDEVRALGIALGLPAKMVWRQPFPGPGLAIRIIGEVTSEKLDMLREA
DAVVREELDAYNGRLFEETGDRNSEHSCWQYFAVLPDIRSVGVMGDERTYARPVIVRAVE
SSDAMTADWAKLPYEVLGKISSRIVGEVDGVNRVVYDVTPKPPATIEWE
Download sequence
Identical sequences E1QY69 X8HTX3
WP_013251085.1.19134 WP_013251085.1.33448 WP_013251085.1.52174 gi|302335006|ref|YP_003800213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]