SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335191|ref|YP_003800398.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335191|ref|YP_003800398.1|
Domain Number 1 Region: 545-693
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 5.62e-30
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0018
Further Details:      
 
Domain Number 2 Region: 289-392
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 0.0000000288
Family PTS-regulatory domain, PRD 0.017
Further Details:      
 
Domain Number 3 Region: 400-478
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.00000188
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.035
Further Details:      
 
Domain Number 4 Region: 2-44
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000012
Family Biotin repressor-like 0.048
Further Details:      
 
Weak hits

Sequence:  gi|302335191|ref|YP_003800398.1|
Domain Number - Region: 84-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000218
Family Biotin repressor-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302335191|ref|YP_003800398.1|
Sequence length 700
Comment transcriptional antiterminator BglG [Olsenella uli DSM 7084]
Sequence
MNKRTVHIVQKLSRTSSPCSLASLARHFEVSERTIRNDIKALNRFLDKQSLGQISFGPKG
VIVLPDGFAQVEGLLPVEDTFAYKMSSEERKDLGAAVLINATDYMTLGEIAELFSVSRAT
ILNDLDGIKGRITESGLEVVSKPSRGILVRGRESAKRTFLRDFITRKVPIVDQWLALPEN
ASMRLDGVTVKKIMNEQCHAHGITMMDGPFRLATNHLCICVMRNRRGARLEELGGRYHDC
AQEDVGGFEREVVGLVSQYCLVDMGTDEALFFAALGQSLRFQGGTQFSIDDMQVQKLSRM
FIRDMSGEIGVDLNGDYDLFEYLSNHLESMFTTEPSHFPETPALMEVVNDQPEVLEAVER
NVGQLERYAGREITPVEVTYIALHICAALERRKNRGVRPRVVVVCDGGIGTSQLLAEELR
GHFEIKVVKVMPAHDVPYIEAYHADLVISTVPLDSCPVDHIVIKLPLKDSEYSLIHEKLA
SIESSIRMSASDLDDLSAQGLLDRIEPVIADRVPKDADLLNAIRIEVRRYFREAQHLEDQ
LVSPYLHQLLPPSHISLDVDCADWRDAIRKSAQPLLDMGYIEERYVESMVHGVEKHGPYI
VLAPGFAIPHSSPENGTIKMGMSLIRLRRPVRFGSDENDPIEFVCTLSAVDRKTHLKAFA
DLLDMIVMPRNSFLDDMRKAADPLEAASLIERYEYLVIQR
Download sequence
Identical sequences E1QYQ4
WP_013251270.1.19134 WP_013251270.1.33448 gi|302335191|ref|YP_003800398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]