SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335202|ref|YP_003800409.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335202|ref|YP_003800409.1|
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily PTS system IIB component-like 2.35e-19
Family PTS system, Fructose specific IIB subunit-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302335202|ref|YP_003800409.1|
Sequence length 93
Comment PTS system lactose/cellobiose-specific transporter subunit IIB [Olsenella uli DSM 7084]
Sequence
MTKKRVLFVCATGIATSTVVEEKVIEYCKDQGIEFDYDQRNVASVPNIADDFDLIVATTN
IPYKLDVPVMSGLPILTGWGSQEVLDQIADALR
Download sequence
Identical sequences E1QYR5 X8HWL7
gi|302335202|ref|YP_003800409.1| WP_013251281.1.19134 WP_013251281.1.33448 WP_013251281.1.52174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]