SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335319|ref|YP_003800526.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335319|ref|YP_003800526.1|
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily DTD-like 6.67e-53
Family DTD-like 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302335319|ref|YP_003800526.1|
Sequence length 154
Comment D-tyrosyl-tRNA(Tyr) deacylase [Olsenella uli DSM 7084]
Sequence
MRALVQRVSEASVAVGGEVVGQCGRGLVVLLGVGPNDDETSCRRLWDKVRDLRVFDDADG
RMNLALGAVGGGVLVVSQFTLYADCRRGLRPSFTGAANPQLGRRLYDRFCALAERDVSHV
GRGVFGADMQVSLVNDGPVTIWLDTDELSRRGVG
Download sequence
Identical sequences E1QZ32
WP_013251398.1.19134 WP_013251398.1.33448 gi|302335319|ref|YP_003800526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]