SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335369|ref|YP_003800576.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335369|ref|YP_003800576.1|
Domain Number 1 Region: 73-138
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.00000000000000602
Family C-terminal domain of arginine repressor 0.002
Further Details:      
 
Domain Number 2 Region: 4-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000068
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302335369|ref|YP_003800576.1|
Sequence length 145
Comment ArgR family transcriptional regulator [Olsenella uli DSM 7084]
Sequence
MVKRRNNRQDAIRDIVRGKSIRTQRTLVDELRSIGFNCTQATVSRDIADMGLRKLSEGIY
VLAEDLHLQRMVSEFVDSVERADNLVVIKSQPGTAPGVAAAVDAASLPEVKGSVAGNDTV
LVVSGGVEAAQDLVNLVNKLRDTRK
Download sequence
Identical sequences E1QZ82
gi|302335369|ref|YP_003800576.1| WP_013251448.1.19134 WP_013251448.1.33448 WP_013251448.1.52174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]