SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302335751|ref|YP_003800958.1| from Olsenella uli DSM 7084

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302335751|ref|YP_003800958.1|
Domain Number 1 Region: 301-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-47
Family Ribonuclease PH domain 1-like 0.00000739
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-41
Family Ribonuclease PH domain 1-like 0.0000351
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.47e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 137-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.71e-19
Family Ribonuclease PH domain 2-like 0.0041
Further Details:      
 
Domain Number 5 Region: 612-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-18
Family Cold shock DNA-binding domain-like 0.00072
Further Details:      
 
Domain Number 6 Region: 556-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000379
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 7 Region: 254-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000128
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302335751|ref|YP_003800958.1|
Sequence length 743
Comment polyribonucleotide nucleotidyltransferase [Olsenella uli DSM 7084]
Sequence
MAKVTHEFDLFGKHYTLETGELAKQATGECLVSCGESTVNVTVVVSKERKNYDFFPLTVD
FVEKMYAVGRIPGGYLKREARPSEKATLTARLIDRPIRPSFPEGFRNEVQIVAMPLVADQ
VNPVDTISVMGASAAMTVGGVPFEGPLACVRVGRDVETGEFIVNPSYEERDASDLDLELA
GSATFISMLEAGAKEVSEDDMLAAMAFGQEAIAAFCEEQRVFFAKVEQANGSIVAREYVL
DEPVPEVHERVFAHFDEMRAALTDADKLARMGKVEALKEAIRAEFSEDEQLQWDRAIPVE
LKSLEKHAMRRMVVECGERVDGRSATEVRPLMVKPDYLPRVHGSGLFQRGQTQVLSIATL
GMLNEWQRLDTIEPVDGKRYIHHYNFPPFCTGETGRMGAPKRREIGHGSLAERALLPVIP
SEDEFPYAIRVVSEVMESNGSSSMASTCGSTLALMDAGVPLARPVSGVAMGLIQEEGKTV
VLTDIQGLEDFLGDMDFKVCGTVKGITAMQMDNKATGLTPEILRQALMQAHEGRMHILEA
MLEQIPAPRESTKESAPQIISIQIPTDKIRDVIGSGGKVIRGIQDDTGATIDIQEDGTVF
IAGTGGAAGEASERIKAIVKVPEAGEEYTGRVVGIQPFGAFVELLPGKDGLLHISRVAQG
RVDKVEDVLSIGDEVKVRVIEVDEKGKISLDRLDKPEAPAVPSGHGERPDHGSHGDGRVG
GRRRHPGDKGSVGTRHPRRHHEG
Download sequence
Identical sequences E1R0B4
gi|302335751|ref|YP_003800958.1| WP_013251830.1.19134 WP_013251830.1.33448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]