SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302388727|ref|YP_003824548.1| from Thermosediminibacter oceani DSM 16646

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302388727|ref|YP_003824548.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.27e-35
Family Ribosomal protein L6 0.0000211
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.57e-27
Family Ribosomal protein L6 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302388727|ref|YP_003824548.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Thermosediminibacter oceani DSM 16646]
Sequence
MSRIGKKPIEIPKGVEVKIEGNIVTIKGPKGSITKEFHKDMQILQEDGKIIVKRPSDDKN
HKALHGLTRSLLANMVNGVVNGYEKSLMLEGVGYRASKQGNKLVLTVGFSHPVEIEAPKG
IEFEVPAQNKIIVRGIDKELVGITAANIRKVKEPEPYKGKGIRYENEVVRRKVGKAGAK
Download sequence
Identical sequences D9RZM7
gi|302388727|ref|YP_003824548.1| WP_013274977.1.79428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]