SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302388869|ref|YP_003824690.1| from Thermosediminibacter oceani DSM 16646

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302388869|ref|YP_003824690.1|
Domain Number 1 Region: 31-107
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000144
Family Apolipoprotein 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302388869|ref|YP_003824690.1|
Sequence length 113
Comment hypothetical protein Toce_0284 [Thermosediminibacter oceani DSM 16646]
Sequence
MALDDLEKAKKEVTASGSGEEARITEIGYFYLAQQINTLMQIHNEFRNNVDLRFDSLRQE
IKQQIDGIKQELKGEMDSVKQQNGGMRQEFKGEIDSVKQQIDGFRQALVGEIN
Download sequence
Identical sequences D9S0Q3
gi|302388869|ref|YP_003824690.1| WP_013275118.1.79428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]