SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302389162|ref|YP_003824983.1| from Thermosediminibacter oceani DSM 16646

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302389162|ref|YP_003824983.1|
Domain Number 1 Region: 58-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000145
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302389162|ref|YP_003824983.1|
Sequence length 367
Comment nucleoside-binding protein [Thermosediminibacter oceani DSM 16646]
Sequence
MKVRKILALGLIFMLVAALLVGCSKQEQPAQQQQQGQQEQGKEKIKVGLVFDVGGRGDLS
FNDSAYAGLEKAKKDFGDKIEVEYREPSGGGQDREQLLRLLAENGFDLIFGVGFLFTDHI
QKVAQEFPDVKFALIDGAIDGLDENSNVTCLLFKEHEGSFLVGAAAAMKSKTGKIGFVGG
MKTPLIERFEAGYMAGAKYVNPNIEILSDYIGTTSEAFKDPVRGKELALKQFKDGADVIY
HASGASGIGVIEAATAEKKFAIGVDSDQSLTAKEDQRPYILTSMVKSVDVAVYETIKALI
EGNFKGGYSIFGLAENGVSYAVNDYNKELISDIQPKLDEIKDKIIKGEIKVPVDKKEYNE
YLKSYFK
Download sequence
Identical sequences D9S1T3
WP_013275409.1.79428 gi|302389162|ref|YP_003824983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]