SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15894065|ref|NP_347414.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15894065|ref|NP_347414.1|
Domain Number 1 Region: 141-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-30
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|15894065|ref|NP_347414.1|
Domain Number - Region: 6-109
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family FCH domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15894065|ref|NP_347414.1|
Sequence length 585
Comment ATP-dependent RNA helicase [Clostridium acetobutylicum ATCC 824]
Sequence
MKKNGAQREFKKLKSQINQIEEIVHHSKPGALIEHESAIRKKLRQLKEFEKEGFRDFDYT
YDRYKELLNDTGKRMLEYYNKKNGTNFDFYEVLEENYNAFYNSGLMTVLTKHHIPKLIAK
EFEEKFPDNPKNEYIETRRMHRKFYIHLGDTNTGKTYNAVERLKTARRGVYLSPLRILAL
ENFEKLNNEGIICDLLTGEEEILKPDSTHISCTIEKVDLKEHYDIAVIDEIQMISDYQRG
IAWSKALLGLKCDEIHICGAINARYILETIIKDCEDEYEIKEYKRAIPLEVEDESFNYKD
IKEGDAVVVFSKKRVLEIAQSYSARGIKASIIYGDLPPEVRKLQYEQFIKKETKVLVTTD
AIGMGVNLPIRRIIFINIRKFDGEQIRELTSQEVKQISGRAGRIGIYDVGYVASAGDTQD
FIKEKLEEEDKSIRRAVIGPSEAILRIKGLPLSEKLALWSTRQEKLDYYTKMDISEYMMI
LDRIKKYKLSEEVQWDLLKVPFDVSKEELMSTFSGYVVEIFINKQDSIFKPECFRGSLDE
LEIYYQKINMYYSFSKIFNLEFDEEWVYSERIRVSEDINNILVGM
Download sequence
Identical sequences Q97KY8
gi|337735994|ref|YP_004635441.1| NP_347414.1.94244 WP_010964096.1.17575 WP_010964096.1.17905 WP_010964096.1.48544 WP_010964096.1.57811 WP_010964096.1.71350 WP_010964096.1.92914 272562.CA_C0778 354253 gi|15894065|ref|NP_347414.1| gi|384457503|ref|YP_005669923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]