SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15894511|ref|NP_347860.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15894511|ref|NP_347860.1|
Domain Number 1 Region: 13-160
Classification Level Classification E-value
Superfamily Resolvase-like 1.24e-31
Family gamma,delta resolvase, catalytic domain 0.00087
Further Details:      
 
Domain Number 2 Region: 352-463
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000916
Family BAR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15894511|ref|NP_347860.1|
Sequence length 544
Comment site-specific DNA recombinase [Clostridium acetobutylicum ATCC 824]
Sequence
MEKIIEKKENLKKVYGYVRLSRDEDKEQASLENQKQIIRTYAKNNGYILVKIFEDDNVSG
MTFDREGLNELKEVIENGNIDILLVKDLSRIGRHKAYSALFMEELRSKKIKVISIAENLD
NMDENNDILIGFKQILNEQYAKDISRKIRAAFHQKQKEGLVIVPPFGYEKNNQTNKIEID
EECAGVVKKIFSLYIGGFGYKKIAQQLTEEKVHTPSWHQFQKSGKVYHAGKKWIGQDIWS
DRTIARILSNEAYIGTLKCHTTTRSVIYKTRGLIPKDEQIIHENFYPPIIDEEVWEKTKA
IKKNRTRGHVRASGNSKIHKYAGLLICKDCGSGFVAKKRKWNGIERIEYICNAYHRFGKT
VCTPHRIREEELDNILCGFLERLKETCEENLNRADKFITKWNSKKRNYDKSIDKIQREIF
SLKTEVKAYAKQLAKQLINEELFQELTQETKEKIDILENQIDTFQEVKKISKNAKAGLLK
SKEIIDKIIEEKDLVSADLQMLVDKIIVHQSCTGELELDIRVNTPFKLHSELKSTFTVIE
EQSS
Download sequence
Identical sequences Q97JP5
gi|337736447|ref|YP_004635894.1| gi|384457954|ref|YP_005670374.1| gi|15894511|ref|NP_347860.1| NP_347860.1.94244 WP_010964541.1.17575 WP_010964541.1.17905 WP_010964541.1.57811 WP_010964541.1.92914 272562.CA_C1228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]