SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15894586|ref|NP_347935.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15894586|ref|NP_347935.1|
Domain Number - Region: 91-175
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family BAR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15894586|ref|NP_347935.1|
Sequence length 252
Comment hypothetical protein CA_C1304 [Clostridium acetobutylicum ATCC 824]
Sequence
MNNNVELAYLIQENYDLIKESKKILRDGSYIYLLKKLKSEFETAKKNYVNRKTELAKIKQ
SYSAISIELRKEREKMETNEYKLYNKAGSNLNMIEKLEGAIEIEKQNLKNLEDEAVDLLD
EEEKLKKEIEDLRLKLVNIKDNFYDYKEKSSEKVEKARQEMIAAKTKIEEIKSKIPKELF
EEISHLMSKSSCAVAKLNGEICGGCRMKVSSMTIDDLINNNSIVHCDNCGRILYYDESEG
KIKRKYKRKIRA
Download sequence
Identical sequences Q97JH9
gi|337736522|ref|YP_004635969.1| NP_347935.1.94244 WP_010964616.1.17575 WP_010964616.1.17905 WP_010964616.1.48544 WP_010964616.1.57811 WP_010964616.1.71350 WP_010964616.1.92914 gi|15894586|ref|NP_347935.1| gi|384458029|ref|YP_005670449.1| 272562.CA_C1304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]