SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15896368|ref|NP_349717.1| from Clostridium acetobutylicum ATCC 824

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15896368|ref|NP_349717.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.74e-35
Family Ribosomal protein L6 0.0000433
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.51e-26
Family Ribosomal protein L6 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15896368|ref|NP_349717.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Clostridium acetobutylicum ATCC 824]
Sequence
MSRVGKQPVEIPSGVTVTVTPDNVVTVKGTKGQLEKAMHKDMKIAVEDNKVVVTRPSDSK
NHKALHGLTRALINNMVIGVTEGFSKTLQLVGVGYKAQLKGKSLILNLGYSHPIEVASIE
GVTFEIPDANTVVVKGINKELVGSVAADIRTFRKPEPYKGKGIKYSDEVIRRKEGKTGK
Download sequence
Identical sequences Q97EJ3
272562.CA_C3118 NP_349717.1.94244 WP_010966397.1.17575 WP_010966397.1.17905 WP_010966397.1.48544 WP_010966397.1.57811 WP_010966397.1.63117 WP_010966397.1.71350 WP_010966397.1.92914 gi|337738325|ref|YP_004637772.1| gi|384459835|ref|YP_005672255.1| gi|15896368|ref|NP_349717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]