SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476415292|ref|YP_007545210.1| from Glaciecola psychrophila 170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476415292|ref|YP_007545210.1|
Domain Number 1 Region: 13-373
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.66e-114
Family FMN-linked oxidoreductases 0.00000000308
Further Details:      
 
Domain Number 2 Region: 384-619
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-43
Family C-terminal domain of adrenodoxin reductase-like 0.0000413
Further Details:      
 
Weak hits

Sequence:  gi|476415292|ref|YP_007545210.1|
Domain Number - Region: 595-664
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0259
Family C-terminal domain of adrenodoxin reductase-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|476415292|ref|YP_007545210.1|
Sequence length 682
Comment NADH:flavin oxidoreductase [Glaciecola psychrophila 170]
Sequence
MTTNTALAQGLEKYPHLLKPLDLGFTQLKNRVLMGSMHTGLEEAPDGHERMAAYFAERAK
GGVGLIVTGGIGPNDEGSTHKDTRRLDTDEAIAGHKTITDAVHEHGSKICMQILHTGRYA
YNPALVAPSAVQAPINPFKPKALDAEGIEKQIQDFIDTSIHAQKAGYDGVEIMGSEGYFL
NQFIAARTNHRDDEWGGSYQNRIRLPIEVVRRVREAVGEHFIIIYRLSMLDLVEGGSTYD
EVVELGKAIEKAGATIINTGIGWHEARIPTIITKVPRAAFTWVTAKFRKALSIPVITSNR
INTPEVAEEVLARGDADMVSMARPFLADPEFVIKAMENRSDEINTCIGCNQACLDHVFEG
KTSSCLVNPRACHETELVIEPTSRVKNIAVIGAGPAGLAAATTAAQRGHKVTIFDSASEL
GGQFNIAKQIPGKEEFFETLRYYARQMELHNVTIKLNTRVDANTLNSSEFDEVIIATGIA
PRKPPIEGIEHSKVMSYVDVIVNKKPVGKKVAIIGAGGIGFDVSEYLSHAGESTSQNIPA
FMKEWGIDMTFGSRSGIEGMKPSPTPSPREIYLLQRKSTKVGKGLGKTSGWAHRAGLLGK
GVSMLAGVEYLKIDDAGLHIKVNDNVQVLDVDNVIICAGQEPLRELVEGLTKPHHLIGGA
DVATELDAKRAISQGTRLAAVL
Download sequence
Identical sequences K7A580
WP_007637771.1.30881 WP_007637771.1.41521 gi|476415292|ref|YP_007545210.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]