SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476416343|ref|YP_007546261.1| from Glaciecola psychrophila 170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476416343|ref|YP_007546261.1|
Domain Number 1 Region: 128-518
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-57
Family GABA-aminotransferase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|476416343|ref|YP_007546261.1|
Sequence length 595
Comment hypothetical protein C427_4814 [Glaciecola psychrophila 170]
Sequence
MQFNYIVYFVLILLGCYLVSKAFIRLQLSRAKHPSLRGHSKWSRRIARKIPFFTYTDSKY
FSTDGAPNNIAQLRRAGMQRLQDKLAKQSIKTLAYCESIEKSISDVRFTSHYRIPFPFRN
RLSKIFKLGSIADETKGSQIKDLDGNWRYDLSGSYGVNVFGYDFYKECMEVGAQKTKLLG
PVLGAYHPVIGENVALIKQISGLDEVSFHMSGTEAVMQAVRLARYHTGKTHLVRLCGAYH
GWWDGVQPGIGNNRATHDVYTLADLSERTLHVLKTRKDIACILINPLQAFHPNADSASDV
SLIASDRDTHFDKAAYSYWLCRIRKICTQKNIVLIFDEVFTGFRLSYRGAQGFFGVQADM
VTYGKTLGGGYPVGVLAGTYSLMKRFKDDKPVDVSFARGTFNSHPYVMGAMNEFLRRTRL
PEIQALYQASESLWNERVADFNQRLLVEKLPLKITNMHSILSVIYTQPSRYNWMLQFYLR
HAGLELSWTGTGRFIMSFSYTDEEFEQVIECFVKAAQQMSQDGWWWSHLELTNKAIKRQF
LGDMLAAMFPILSPVLRPLLPAPLSKLKCSVNLTNESLTAAEFVVPPNNNTNQVG
Download sequence
Identical sequences K6ZVN4
gi|476416343|ref|YP_007546261.1| WP_007642561.1.30881 WP_007642561.1.41521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]