SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476416355|ref|YP_007546273.1| from Glaciecola psychrophila 170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476416355|ref|YP_007546273.1|
Domain Number 1 Region: 144-556
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.4e-48
Family Cystathionine synthase-like 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|476416355|ref|YP_007546273.1|
Sequence length 606
Comment Cys/Met metabolism pyridoxal-phosphate-dependent protein [Glaciecola psychrophila 170]
Sequence
MSAKNTTALEVMQQAKILSPKRNTTQATTIGELTDEQLAHFGIDKDSEYGQALFNTAQHL
YYTQANMQQLWQITSDTLEGLSKENKVAYFNAKKFLSFQIAKILDTLQNPFRATYQSLSK
QSGSQVSKSHYPLFDNVTALFSATPVVVRTATYVYACTEWVDDAFQGKESTHQIYSRLLN
PTNISLANAIVDLEAGPYAADYLAWNFNSGMAAIDALLSNILNHGDVLIVSRNVYGGVYQ
LLHDYFARENRMNVQLEWFDGYSEDEFASFLQETKAKHSERLDANHALHVYMESPCNPHG
YVLDVAGISKIAHASGHVVMLDATLATPILHQPLQRLDKAERPDYVMHSYTKDICGSGAT
TAGVVIGEAYRMFQGKGDCVNGYEWSKTMFWDVYYIKGAFLDSEKAFDVLTGMKTLEMRI
MQKVINTFVFSQFLASHQDFNVNCHAIDGHPNAALREGQMRHGWPCALFTVDMQGTDISR
PIISRDTFVRFFDALEPAFSHQVSIGQHNTIVLCPALTSHSELDATAQAKSGIYLTTMRI
AMGTDNVKELVAHFINSARLHIDPVMPGFSDKFMSADEIDALYMKTSLRVSEQHYSSGAS
VKDMLG
Download sequence
Identical sequences K7AH81
WP_007642597.1.30881 WP_007642597.1.41521 gi|476416355|ref|YP_007546273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]