SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529236557|ref|YP_008397416.1| from Proteus mirabilis BB2000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529236557|ref|YP_008397416.1|
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily YccV-like 8.89e-29
Family YccV-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529236557|ref|YP_008397416.1|
Sequence length 106
Comment hypothetical protein BB2000_0859 [Proteus mirabilis BB2000]
Sequence
MMIASKFGIGQQVRHKLLGYLGVVVDVDAEYSLDQPNEDDIASNMTLRSAPWYHVVMEDD
EGQPVHTYLAEAQITYELSDEHLDNDSMDELSQSIRNQLQAPRLRN
Download sequence
Identical sequences B4ET62
gi|529236557|ref|YP_008397416.1| gi|197284682|ref|YP_002150554.1| 529507.PMI0792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]