SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529237068|ref|YP_008397927.1| from Proteus mirabilis BB2000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529237068|ref|YP_008397927.1|
Domain Number 1 Region: 449-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000785
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529237068|ref|YP_008397927.1|
Sequence length 594
Comment sulfate transporter [Proteus mirabilis BB2000]
Sequence
MNGKRIIKWMPGLGLLFNYQREYLGYDIKAGLSVAAVALPVAIAYTELLGINAIVGLYAC
ILPMIMYALFGTSRQLITGPDAATCAVIAAVVIPLSVGDENTRWQLAIIMTAMTGFWCIL
ASHFRFGAFTDFLSRPILQGLLNGVAITIMVGQLSKVFGFTTSPEYLIEKLLEVPFRLKE
AHWPTLLMSALTLALLLGIRHFRQRWPAPLIAMVVMTYLSWQFDLVNYGIAIVDKEADNG
DLFLPIVSMSGFHLGSLRELIVPSINLAVISFVSFMMTARSFASKNGYDVDADQELKALG
IANIASALSQGFAVSAASSRTAVNDSVGGKTQLVSIVAALVILVVLLFMTDFIAYIPLSS
LGVVLIVSSWSLLSIRHIWSYRKRNRQAFTLATFTLLAVLLAGLINGIGFAVLLGLLQFL
RIVFRPSDQLLGVDEQGMIHSINQGNGIESISGLMMYRFNSPLTYFNVGYFKKRVLQLVD
SAPQRPAWLAVDATVSFTYDDVSVFAVIDELIRELRIKGVKLVLAGRRTELNRWIVRNKI
TINDDDLIIAPDLYFVIRLYQSRQQIKEKHKQQQQEPFAEDNQATFIKDTETRG
Download sequence
Identical sequences gi|529237068|ref|YP_008397927.1| WP_020945699.1.49957 WP_020945699.1.9880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]