SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38232902|ref|NP_938669.1| from Corynebacterium diphtheriae NCTC 13129

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38232902|ref|NP_938669.1|
Domain Number 1 Region: 8-509
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.66e-189
Family Heme-dependent catalases 0.000000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38232902|ref|NP_938669.1|
Sequence length 512
Comment catalase [Corynebacterium diphtheriae NCTC 13129]
Sequence
MTSPVDPILNKGERTEAAPHTTRAGGQPVASENISITAGPQGANVLNDLHLIEKLAHFNR
ERVPERNPHAKGHGAFGELHITEDVSQYTKAKLFQKGTVTPMAVRFSTVAGEKGSPDTWR
DVHGFALRFYTQDGNYDIVGNNTPTFFLRDAMKFPDFIHSQKRLGSSGLRDADMQWDFWT
RTPESAHQVTYLMGDRGTPKTSRHQDGFGSHTYQWINEDGQPVWVKYHFKTRQGWETFTD
AEAQEMAGKNADYQREDLYNAIERGDFPIWDVKVQIMPFDEAETYRWNPFDLTKTWSQKD
YPLIDVGYFVLNRNPQNFFAQIEQLALDPANLVPGVGLSPDRMLMARAFAYADAQRYRIG
PNYQQLPINQPVVPVNTYQHEGPMAYHFNPADAPVHTPNRFGKGAGYLDDGQTSSSGATY
GQAQDLYVNPDPHGTDLTRAAYVKHADDDDFMQAGILYREVYDDAAKERFVDNVTNAMAG
VSPETEERVYWYWTQVDENLGAKIREAFAAKK
Download sequence
Identical sequences A0A246CC88 Q6NJW2
257309.DIP0281 WP_010934173.1.12056 WP_010934173.1.15382 WP_010934173.1.16169 WP_010934173.1.21235 WP_010934173.1.22617 WP_010934173.1.2359 WP_010934173.1.24021 WP_010934173.1.24410 WP_010934173.1.24452 WP_010934173.1.24530 WP_010934173.1.34071 WP_010934173.1.42841 WP_010934173.1.43592 WP_010934173.1.4375 WP_010934173.1.44089 WP_010934173.1.4494 WP_010934173.1.52928 WP_010934173.1.58917 WP_010934173.1.69403 WP_010934173.1.70634 WP_010934173.1.71515 WP_010934173.1.73245 WP_010934173.1.73495 WP_010934173.1.73977 WP_010934173.1.77064 WP_010934173.1.80770 WP_010934173.1.816 WP_010934173.1.82314 WP_010934173.1.82318 WP_010934173.1.86272 WP_010934173.1.91366 WP_010934173.1.93248 WP_010934173.1.95894 WP_010934173.1.96122 WP_010934173.1.97188 WP_010934173.1.98240 WP_010934173.1.98565 gi|38232902|ref|NP_938669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]