SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38233435|ref|NP_939202.1| from Corynebacterium diphtheriae NCTC 13129

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38233435|ref|NP_939202.1|
Domain Number 1 Region: 16-193
Classification Level Classification E-value
Superfamily Formyltransferase 7.33e-49
Family Formyltransferase 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38233435|ref|NP_939202.1|
Sequence length 207
Comment phosphoribosylglycinamide formyltransferase [Corynebacterium diphtheriae NCTC 13129]
Sequence
MVAVTSLSSTEQAAPIVVLASGSGTLLQAIIDNQERYRVVAVVADVECFALERAKQAGIP
THIVPLEKGADRHEWNLALARTVERYEPTIVVSAGFMKILGEGFLRTFEGRTINTHPALL
PAFPGAHAVRDALNYGVRVTGSTVHFVDSGVDTGAIIAQRPVSIERGEDESHLHERIKQV
ERQLIVSVLNSAVTEKESGEVSFTHER
Download sequence
Identical sequences A0A246CC74 Q6NID9
gi|38233435|ref|NP_939202.1| WP_010934604.1.12056 WP_010934604.1.15382 WP_010934604.1.16169 WP_010934604.1.16923 WP_010934604.1.21235 WP_010934604.1.22617 WP_010934604.1.2359 WP_010934604.1.24021 WP_010934604.1.24410 WP_010934604.1.24530 WP_010934604.1.34071 WP_010934604.1.42841 WP_010934604.1.43592 WP_010934604.1.4375 WP_010934604.1.4494 WP_010934604.1.52928 WP_010934604.1.58917 WP_010934604.1.67410 WP_010934604.1.69403 WP_010934604.1.70634 WP_010934604.1.71515 WP_010934604.1.73245 WP_010934604.1.73495 WP_010934604.1.73977 WP_010934604.1.77064 WP_010934604.1.80770 WP_010934604.1.816 WP_010934604.1.82314 WP_010934604.1.86272 WP_010934604.1.91366 WP_010934604.1.93248 WP_010934604.1.93774 WP_010934604.1.95894 WP_010934604.1.96122 WP_010934604.1.97188 WP_010934604.1.98240 WP_010934604.1.98565 257309.DIP0838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]