SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38234824|ref|NP_940591.1| from Corynebacterium diphtheriae NCTC 13129

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38234824|ref|NP_940591.1|
Domain Number 1 Region: 61-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.8e-23
Family Ribosomal protein L9 C-domain 0.00047
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.58e-18
Family Ribosomal protein L9 N-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38234824|ref|NP_940591.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Corynebacterium diphtheriae NCTC 13129]
Sequence
MKLILTADVENLGVAGDIVEVKDGYGRNLLLPRGLAIVATRGAEKQIEGIKRAQEAREIR
DLDHAREVKAQLEALEGVSVAVRTSEKGKLFGSVKAEDVAAAVKKAGGPNLDKRSIELPK
SLVKATGAYKVNVKLHSDIAATVNFEVVAA
Download sequence
Identical sequences A0A0F5DCU0 Q6NEI5
gi|376255342|ref|YP_005143801.1| gi|376243859|ref|YP_005134711.1| gi|38234824|ref|NP_940591.1| gi|376285794|ref|YP_005159004.1| gi|375294085|ref|YP_005128625.1| gi|376294250|ref|YP_005165924.1| gi|376258106|ref|YP_005145997.1| gi|376246726|ref|YP_005136965.1| gi|375291890|ref|YP_005126430.1| 257309.DIP2289 WP_003853141.1.100437 WP_003853141.1.101620 WP_003853141.1.12056 WP_003853141.1.12077 WP_003853141.1.13923 WP_003853141.1.14799 WP_003853141.1.15382 WP_003853141.1.16169 WP_003853141.1.16616 WP_003853141.1.17258 WP_003853141.1.18730 WP_003853141.1.20047 WP_003853141.1.21235 WP_003853141.1.21794 WP_003853141.1.22617 WP_003853141.1.2359 WP_003853141.1.24021 WP_003853141.1.24410 WP_003853141.1.24452 WP_003853141.1.24530 WP_003853141.1.26586 WP_003853141.1.27503 WP_003853141.1.2787 WP_003853141.1.29044 WP_003853141.1.31738 WP_003853141.1.33126 WP_003853141.1.33228 WP_003853141.1.33967 WP_003853141.1.34071 WP_003853141.1.35664 WP_003853141.1.35693 WP_003853141.1.36295 WP_003853141.1.36771 WP_003853141.1.38550 WP_003853141.1.39547 WP_003853141.1.41054 WP_003853141.1.41144 WP_003853141.1.42841 WP_003853141.1.43592 WP_003853141.1.4375 WP_003853141.1.44089 WP_003853141.1.44404 WP_003853141.1.4494 WP_003853141.1.47154 WP_003853141.1.48478 WP_003853141.1.49767 WP_003853141.1.50903 WP_003853141.1.52799 WP_003853141.1.52928 WP_003853141.1.55162 WP_003853141.1.56495 WP_003853141.1.56727 WP_003853141.1.56741 WP_003853141.1.57683 WP_003853141.1.57961 WP_003853141.1.58917 WP_003853141.1.60808 WP_003853141.1.63172 WP_003853141.1.63803 WP_003853141.1.64345 WP_003853141.1.67038 WP_003853141.1.67410 WP_003853141.1.67504 WP_003853141.1.67527 WP_003853141.1.69403 WP_003853141.1.69457 WP_003853141.1.70128 WP_003853141.1.70439 WP_003853141.1.70634 WP_003853141.1.71515 WP_003853141.1.72064 WP_003853141.1.73245 WP_003853141.1.73495 WP_003853141.1.73977 WP_003853141.1.74211 WP_003853141.1.74589 WP_003853141.1.7622 WP_003853141.1.76681 WP_003853141.1.77064 WP_003853141.1.80770 WP_003853141.1.816 WP_003853141.1.82314 WP_003853141.1.82318 WP_003853141.1.8291 WP_003853141.1.83106 WP_003853141.1.83112 WP_003853141.1.85905 WP_003853141.1.86054 WP_003853141.1.86272 WP_003853141.1.87428 WP_003853141.1.91366 WP_003853141.1.92337 WP_003853141.1.93248 WP_003853141.1.94633 WP_003853141.1.95829 WP_003853141.1.95894 WP_003853141.1.96122 WP_003853141.1.97137 WP_003853141.1.97188 WP_003853141.1.98240 WP_003853141.1.98565 WP_003853141.1.99854 gi|376249559|ref|YP_005141503.1| gi|376288789|ref|YP_005161355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]