SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C32A3.3a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C32A3.3a
Domain Number 1 Region: 261-291,327-359
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000000017
Family RILP dimerisation region 0.0061
Further Details:      
 
Weak hits

Sequence:  C32A3.3a
Domain Number - Region: 81-184
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0017
Family Formin homology 2 domain (FH2 domain) 0.0086
Further Details:      
 
Domain Number - Region: 8-84
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0797
Family Motor proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C32A3.3a   Protein: CE33977   Gene: WBGene00007860
Sequence length 419
Comment CE33977 WBGene00007860 coiled coil domains status:Partially_confirmed UniProt:Q93317 protein_id:CAB03766.4
Sequence
MAARAASPQSPSKQITVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAM
AAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSL
VNENRNLSTTVSSLPNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQC
QVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNIELKKLVKE
TDRACKDMQLANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRL
DDDDDFDRNPLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQF
PLLQRLWSDGVPPPRIFCKRVSSTTGSCDPTIPQLMIMAPMLLPVHIFFSAMVFMFQCL
Download sequence
Identical sequences G5EFB9
C32A3.3a NP_741113.3.50509 C32A3.3a.1 C32A3.3a.2 C32A3.3a.3 C32A3.3a.1 G_YK7552 6239.C32A3.3a.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]