SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C32A3.3b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C32A3.3b
Domain Number 1 Region: 252-282,318-350
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000000017
Family RILP dimerisation region 0.0061
Further Details:      
 
Weak hits

Sequence:  C32A3.3b
Domain Number - Region: 75-210
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00144
Family Formin homology 2 domain (FH2 domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C32A3.3b   Protein: CE33978   Gene: WBGene00007860
Sequence length 410
Comment CE33978 WBGene00007860 status:Partially_confirmed UniProt:Q8MM78 protein_id:CAD44106.2
Sequence
MPIKNCKVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENE
EIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLST
TVSSLPNHADSPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQCQVENLQNSI
EKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNIELKKLVKETDRACKDMQ
LANQDNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRN
PLQPDTSSAQSLGVDGDDLPVYGPMPKEPDEKLHPWKYERKDSGVRKFIQFPLLQRLWSD
GVPPPRIFCKRVSSTTGSCDPTIPQLMIMAPMLLPVHIFFSAMVFMFQCL
Download sequence
Identical sequences G5EDL7
NP_741114.2.50509 C32A3.3b C32A3.3b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]