SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK1098.10a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1098.10a
Domain Number 1 Region: 801-998
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000235
Family Quinoprotein alcohol dehydrogenase-like 0.053
Further Details:      
 
Weak hits

Sequence:  ZK1098.10a
Domain Number - Region: 409-452
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00353
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK1098.10a   Protein: CE00363   Gene: WBGene00006755
Sequence length 1139
Comment CE00363 WBGene00006755 locus:unc-16 Coiled coil protein status:Confirmed UniProt:P34609 protein_id:CAA80140.1
Sequence
MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLK
EDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNAT
DHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQL
RNKMGMAASVDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDI
PQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTGNLVDP
AEFASAVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDEN
LSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDR
NAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKSGGIWEFFSSLLGDSVTPPASSRG
NRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKEDGRIEAYGWSLPNVEA
EVSSVPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIVGDPIYFAPASMKKTKTS
NHRPELEDEIKRARNLDARESELDEWQSSSLVWVVSSNQGKSLIAVLDANNPNNIIETFP
ACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPEGLDGTDLGACEWVELRKM
EDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKEDPLPPPANRPGGRAALPPH
IRDAMSKYDGVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYK
SRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVV
LDAESLQIVKVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEP
YVTKMLGTSKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAG
PGGLVRVYGATSENATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLGVPGASKNGED
ESAEVTLRRMLIMSGGDGYIDFRIGEENEPELTGQSIRPRDMSHLIIWEVDAELPILSK
Download sequence
Identical sequences NP_741263.3.50509 ZK1098.10a ZK1098.10 ZK1098.10a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]