SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK1098.10b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1098.10b
Domain Number 1 Region: 820-1019
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000623
Family WD40-repeat 0.024
Further Details:      
 
Weak hits

Sequence:  ZK1098.10b
Domain Number - Region: 427-470
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00366
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK1098.10b   Protein: CE31846   Gene: WBGene00006755
Sequence length 1157
Comment CE31846 WBGene00006755 locus:unc-16 status:Confirmed UniProt:P34609 protein_id:CAD45611.1
Sequence
MACNLSPVNEMADSITSSTPSEIVYGGPGSPDEHRTMSDKVQTMASAIYRELETMIKVHG
EDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKY
IEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERY
NTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAASVDASSIRGVSDLISA
HMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAA
SPKQSEEEEADETTSVDPKENNDLLGADLTGMGREVENLIKENSELLDMKNALNIVKNDL
INQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPM
AMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKSGGIWE
FFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVK
KEDGRIEAYGWSLPNVEAEVSSVPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWI
VGDPIYFAPASMKKTKTSNHRPELEDEIKRARNLDARESELDEWQSSSLVWVVSSNQGKS
LIAVLDANNPNNIIETFPACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPE
GLDGTDLGACEWVELRKMEDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKED
PLPPPANRPGGRAALPPHIRDAMSKYDGVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQ
CLRRIKMPDAVLSIVHYKSRIFAALANGTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRS
LCLVSTNIWATYKNCVVVLDAESLQIVKVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTL
RLYHAHTYEHLQDVDIEPYVTKMLGTSKLDFSYMRTTALLVSNRRLWIGTGTGVIISVPF
SGQLEKKIETKDSKRPAGPGGLVRVYGATSENATNDEKTNDDFIPYCNLAHAQLSFHGHK
DSVKFFLGVPGASKNGEDESAEVTLRRMLIMSGGDGYIDFRIGEENEPELTGQSIRPRDM
SHLIIWEVDAELPILSK
Download sequence
Identical sequences P34609
NP_001022981.1.50509 ZK1098.10b ZK1098.10b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]