SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK1098.10d from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1098.10d
Domain Number 1 Region: 847-1044
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000204
Family Quinoprotein alcohol dehydrogenase-like 0.053
Further Details:      
 
Weak hits

Sequence:  ZK1098.10d
Domain Number - Region: 427-470
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00366
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK1098.10d   Protein: CE41491   Gene: WBGene00006755
Sequence length 1185
Comment CE41491 WBGene00006755 locus:unc-16 status:Confirmed UniProt:A7LPE4 protein_id:CAO82058.1
Sequence
MACNLSPVNEMADSITSSTPSEIVYGGPGSPDEHRTMSDKVQTMASAIYRELETMIKVHG
EDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKY
IEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERY
NTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAASVDASSIRGVSDLISA
HMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAA
SPKQSEEEEADETTSVDPKENNDLLGADLTGMGREVENLIKENSELLDMKNALNIVKNDL
INQVDELNSENMILRDENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPM
AMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKSGGIWE
FFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVK
KEDGRIEAYGWSLPNVEAEVSSVPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWI
VGDPIYFAPASMKKTKTSNHRPELEDEIKRARNLDARESELDEWQSSSLVWVVSSNQGKS
LIAVLDANNPNNIIETFPACDSHLLCIQAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPE
GLDGTDLGACEWVELRKMEDSEDGVPTYCSNDMKPSPKRTRDFSISEVAPVDSSAPVKAK
TKLSRVSENVVPDETPKLIPLEKLKKEDPLPPPANRPGGRAALPPHIRDAMSKYDGVSGQ
MSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYKSRIFAALANGTIAI
FHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIVKVFAA
HPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGTSKLDFS
YMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAGPGGLVRVYGATSEN
ATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLGVPGASKNGEDESAEVTLRRMLIMS
GGDGYIDFRIGEENEPELTGQSIRPRDMSHLIIWEVDAELPILSK
Download sequence
Identical sequences A7LPE4
NP_001122748.1.50509 ZK1098.10d 6239.ZK1098.10d ZK1098.10d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]