SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK1098.10e from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1098.10e
Domain Number 1 Region: 852-1049
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000251
Family Quinoprotein alcohol dehydrogenase-like 0.053
Further Details:      
 
Weak hits

Sequence:  ZK1098.10e
Domain Number - Region: 460-503
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00366
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK1098.10e   Protein: CE43483   Gene: WBGene00006755
Sequence length 1190
Comment CE43483 WBGene00006755 locus:unc-16 status:Partially_confirmed UniProt:C0P271 protein_id:CAX51690.1
Sequence
MACNLSPVNEMADSITSSTPSEIVYGGPGSPDEHRTMSDKVQTMASAIYRELETMIKVHG
EDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKY
IEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERY
NTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAASVDASSIRGVSDLISA
HMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAA
SPKQSEEEEADETTSVDPKENNDLLGADLTDDESDWNGLGLIPRRHRPNEMLDDDDTSDD
GSLGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILRDENLSRQMVSEK
MQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLME
LEESIKWTEMQRAKKMQQQQQNVNQKKSGGIWEFFSSLLGDSVTPPASSRGNRASSSRGK
MTRSVEYIDPDMISERRAAERREQYKLVREHVKKEDGRIEAYGWSLPNVEAEVSSVPIPV
CCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIVGDPIYFAPASMKKTKTSNHRPELEDE
IKRARNLDARESELDEWQSSSLVWVVSSNQGKSLIAVLDANNPNNIIETFPACDSHLLCI
QAVSGVMEGEPEMNEEQSKKYLSGGGKIKDLPEGLDGTDLGACEWVELRKMEDSEDGVPT
YCSNDMKPSPKRTRDFSISEVAPVDSSAPVKEDPLPPPANRPGGRAALPPHIRDAMSKYD
GVSGQMSGALPTVWMGGQNQYIYIHSAVTAWKQCLRRIKMPDAVLSIVHYKSRIFAALAN
GTIAIFHRNKHGEWSDEGYHSLRVGSATSSVRSLCLVSTNIWATYKNCVVVLDAESLQIV
KVFAAHPRKDSQVRNMQWVGAGVWLSIRLDSTLRLYHAHTYEHLQDVDIEPYVTKMLGTS
KLDFSYMRTTALLVSNRRLWIGTGTGVIISVPFSGQLEKKIETKDSKRPAGPGGLVRVYG
ATSENATNDEKTNDDFIPYCNLAHAQLSFHGHKDSVKFFLGVPGASKNGEDESAEVTLRR
MLIMSGGDGYIDFRIGEENEPELTGQSIRPRDMSHLIIWEVDAELPILSK
Download sequence
Identical sequences C0P271
NP_001255008.1.50509 ZK1098.10e ZK1098.10d ZK1098.10e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]