SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C56C10.10 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C56C10.10
Domain Number 1 Region: 187-310
Classification Level Classification E-value
Superfamily TPR-like 7.85e-24
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Weak hits

Sequence:  C56C10.10
Domain Number - Region: 66-106,144-169
Classification Level Classification E-value
Superfamily FKBP-like 0.000725
Family FKBP immunophilin/proline isomerase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: C56C10.10   Protein: CE02564   Gene: WBGene00016966
Sequence length 342
Comment CE02564 WBGene00016966 TPR domain status:Confirmed UniProt:Q18888 protein_id:AAA68778.1
Sequence
MSVRATVVKRTISGGKGKISEYCDGTKAVFHYQALFPIEKHEKGQPLSLEKDAFKSIDDT
RKPWPHGYGKPLEIVFGKKFQLPVFEQCLKTMLVDEISQFDVECIDLVQYPFVSKKLRDL
VKPCDGKHSHAHTTHMCAASIAQGTGYEELDELMKNPRPLRFVFHLLQVFEPDQYVHDSW
QLDEDDKLKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVELDR
KNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDL
KLLLRNHPAAASVVAREMKIVTERRAEKKADSRVTYSKMFQP
Download sequence
Identical sequences Q18888
APC37478.1 C56C10.10 6239.C56C10.10 NP_495339.1.50509 C56C10.10 C56C10.10 C56C10.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]