SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F08B6.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F08B6.2
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000106
Family Transducin (heterotrimeric G protein), gamma chain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: F08B6.2   Protein: CE20656   Gene: WBGene00001682
Sequence length 62
Comment CE20656 WBGene00001682 locus:gpc-2 status:Confirmed UniProt:Q9TYS9 protein_id:AAC78236.1
Sequence
MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQEDPLVNPIDKKVNPWAEKSKCS
ML
Download sequence
Identical sequences G5ECT6
NP_491935.1.50509 F08B6.2 F08B6.2 6239.F08B6.2 F08B6.2 F08B6.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]